Fresh Summer Rolls with Rice Vermicelli
Vietnamese Medium

Fresh Summer Rolls with Rice Vermicelli

Crisp vegetables and tender rice noodles wrapped in delicate rice paper

vietnamesevegetariandairy-freehealthysnackappetizerno-cook
(0 ratings)
⏱️ 45 minutes 35 minutes prep · 10 minutes cook
🍽️ 4 pieces Makes
270 Calories
6g Protein
48g Carbs
6g Fat

Why This Recipe Works

These rolls rely on the contrast between tender rice noodles and a crisp vegetable filling. The key is to soak the rice paper until just pliable; too long and it becomes unmanageably sticky, while too short and it will crack during rolling.


Instructions

1

Whisk the lime juice, vegetarian fish sauce, and sugar in a small bowl until the sugar is completely dissolved.

2

Bring a large pot of water to a boil, then remove from the heat and stir in the rice vermicelli and salt. Let the noodles sit, stirring occasionally, until they are tender but still have a slight bite, about 10 minutes.

3

Drain the noodles well, transfer them to a bowl, and toss with a portion of the prepared lime-sauce mixture.

4

Combine the shredded carrot, chopped peanuts, and minced jalapeño with a portion of the lime-sauce mixture in one bowl, then toss the cucumber matchsticks with the remaining sauce mixture in a separate bowl.

5

Prepare your workspace by laying a clean, damp kitchen towel on the counter and filling a wide, shallow dish with room-temperature water. Submerge one rice paper wrapper at a time until it is just pliable, about 2 minutes, then lay it flat on the towel.

6

Scatter basil and cilantro leaves over the center of the wrapper, followed by a layer of cucumber sticks, the carrot mixture, and a portion of noodles, leaving a clear border around the edges.

7

Fold the bottom of the wrapper up over the filling, tuck in the sides, and roll forward into a tight cylinder. Place the finished roll on a lettuce leaf and keep covered with a second damp towel to prevent the rice paper from hardening.

8

Repeat the assembly process with the remaining ingredients and serve immediately with peanut dipping sauce, using the lettuce leaves to wrap the exterior of each roll for extra crunch.


🍽️ Complete the Meal

Extra Rice Vermicelli
📅
Make Ahead: Rolls can be prepared up to 4 hours in advance if kept tightly covered with a damp kitchen towel in the refrigerator.
🧊
Storage: Refrigerate for up to 2 days. Best consumed fresh.

Frequently Asked Questions

Can I freeze this recipe?

Refrigerate for up to 2 days. Best consumed fresh.

Can I make this ahead of time?

Rolls can be prepared up to 4 hours in advance if kept tightly covered with a damp kitchen towel in the refrigerator.

What substitutions can I make?
  • vegetarian fish sauce: soy sauce or tamari
Rohit Bothra
Recipe by

Rohit Bothra

Self-taught cook exploring global vegetarian cuisine from my Atlanta kitchen.

Learn more about me →
⏱️ 00:00