Farfalle with Sautéed Mushrooms and Thyme
Italian Easy

Farfalle with Sautéed Mushrooms and Thyme

A rich, woodsy pasta featuring a mix of meaty cremini and chewy shiitakes

italianvegetarianpastaweeknightquickdinner
(0 ratings)
⏱️ 40 minutes 15 minutes prep · 17 minutes cook
🍽️ 5 Serves
595 Calories
22g Protein
76g Carbs
24g Fat

Why This Recipe Works

Using a mix of meaty cremini and chewy shiitake mushrooms creates a depth of flavor that a single variety cannot achieve. Cooking the mushrooms until they are deeply browned provides a concentrated, woodsy base for the creamy thyme-infused sauce.


Instructions

1

Bring a large pot of heavily salted water to a boil.

2

Melt the butter and olive oil in a large skillet over medium-high heat until the oil shimmers. Add the shallots and garlic and cook until softened and fragrant, about 2 minutes.

3

Stir in the shiitake and cremini mushrooms with a pinch of salt. Cook, stirring occasionally, until the mushrooms release their liquid, the moisture evaporates, and the mushrooms become deeply browned, 10 to 12 minutes.

4

Drop the farfalle into the boiling water as soon as the mushrooms begin browning in the skillet. Cook until the pasta is al dente.

5

Stir the thyme into the skillet and cook until fragrant. Pour in the vegetable broth, heavy cream, and lemon juice. Simmer the mixture until the sauce reduces slightly, looks glossy, and coats the back of a spoon, about 5 minutes.

6

Drain the pasta and return it to the pot. Add the mushroom sauce, Parmesan, and parsley, tossing well to coat the noodles evenly. Season with salt and pepper to taste.

7

Serve immediately while hot, passing extra Parmesan at the table.


🍽️ Complete the Meal

Roasted asparagus with lemonSimple arugula salad with balsamic vinaigrette
🧊
Storage: Refrigerate up to 3 days.

Frequently Asked Questions

Can I freeze this recipe?

Refrigerate up to 3 days.

What substitutions can I make?
  • cremini mushrooms: also known as baby bella mushrooms
  • farfalle: campanelle or fusilli
Rohit Bothra
Recipe by

Rohit Bothra

Self-taught cook exploring global vegetarian cuisine from my Atlanta kitchen.

Learn more about me →
⏱️ 00:00