Curried Lentil Soup
Indian-inspired Easy

Curried Lentil Soup

A hearty, aromatic soup with a luscious, partially pureed broth

indianvegetarianvegandairy-freeweeknightone-potsoup
(0 ratings)
⏱️ 1 hour 20 minutes prep · 32 to 47 minutes cook
🍽️ 5 Serves
240 Calories
12g Protein
30g Carbs
6g Fat

Why This Recipe Works

Sautéing the lentils with the aromatics before adding liquid deepens their flavor and helps them maintain a firm-tender bite. Pureeing a portion of the soup at the end creates a rich, velvety texture without the need for cream.


Instructions

1

Heat the oil in a large Dutch oven over medium-high heat until it shimmers. Add the onion and carrots and cook until softened and just starting to brown, about 5 minutes.

2

Stir in the garlic, curry powder, tomatoes, bay leaf, thyme, and lentils. Season with a pinch of salt and pepper. Cook, stirring frequently, until the vegetables are well-softened and the lentils have darkened slightly, 8 to 10 minutes.

3

Pour in the wine and use a wooden spoon to scrape up any browned bits from the bottom of the pot. Simmer until the wine has almost completely evaporated, about 2 minutes.

4

Add the vegetable broth and water. Bring the liquid to a boil, then immediately reduce the heat to low. Cover and simmer gently until the lentils are tender but still holding their shape, 30 to 45 minutes depending on the variety of lentil.

5

Discard the bay leaf. Transfer 2 cups of the soup to a blender and process until completely smooth. Return the pureed soup to the pot to thicken the broth.

6

Stir in the parsley and season with additional salt and pepper to taste. Serve hot with crusty bread or rice.

💡 If the soup becomes too thick while sitting, thin it with a little extra water or broth before reheating.


🍽️ Complete the Meal

🧊
Storage: Refrigerate up to 4 days. Freezes well for 2 months.

Frequently Asked Questions

Can I freeze this recipe?

Refrigerate up to 4 days. Freezes well for 2 months.

What substitutions can I make?
  • lentils: Lentilles du Puy (French green) are preferred, but brown or black lentils work well.
Rohit Bothra
Recipe by

Rohit Bothra

Self-taught cook exploring global vegetarian cuisine from my Atlanta kitchen.

Learn more about me →
⏱️ 00:00