Japanese Tofu Tonkatsu
Japanese Easy

Japanese Tofu Tonkatsu

Extra-firm tofu slabs breaded in panko and fried to a golden crunch

japaneseveganvegetarianfrieddinnerweeknighttofu
(0 ratings)
⏱️ 35 minutes 20 minutes prep · 15 minutes cook
🍽️ 2 Serves
540 Calories
22g Protein
48g Carbs
28g Fat

Why This Recipe Works

This plant-based take on a Japanese classic relies on extra-firm tofu and a light, airy panko coating. The result is a satisfyingly crunchy slab that works just as well in a sandwich as it does over a bowl of steamed rice.


Instructions

1

Press the tofu for at least 10 minutes to drain excess liquid, then slice into thick slabs. Rub the first portion of salt onto both sides of the tofu.

2

Whisk the flour, cornstarch, baking powder, the remaining salt, and water in a medium bowl until the batter is smooth. Spread the bread crumbs onto a shallow plate or tray nearby.

3

Dip each tofu slab into the batter, letting any excess drip off, then press into the bread crumbs until fully and evenly coated.

4

Fill a large skillet with enough oil to reach halfway up the sides of the tofu and heat over high heat until the oil shimmers. Carefully place the tofu in the pan—it should sizzle immediately—ensuring the pieces do not touch.

5

Fry for 4 to 5 minutes, flipping halfway through, until the exterior is deeply golden brown and crisp. Transfer the slabs to a wire rack or paper towel-lined plate to drain; let them rest for a few minutes so the crust sets.

6

Whisk the ketchup, soy sauce, vinegar, and sugar in a small bowl until the sugar has completely dissolved.

7

Slice the tofu diagonally into strips and drizzle with the sauce. Sprinkle with sesame seeds and serve while still hot and crackling, alongside shredded cabbage and lemon wedges.


🍽️ Complete the Meal

Steamed white rice
📅
Make Ahead: The tonkatsu sauce can be made several days in advance and stored in the refrigerator.
🧊
Storage: Store leftovers in an airtight container for up to 2 days; reheat in an oven or air fryer to restore crispness.

Frequently Asked Questions

Can I freeze this recipe?

Store leftovers in an airtight container for up to 2 days; reheat in an oven or air fryer to restore crispness.

Can I make this ahead of time?

The tonkatsu sauce can be made several days in advance and stored in the refrigerator.

What substitutions can I make?
  • dark brown sugar: granulated sugar
Rohit Bothra
Recipe by

Rohit Bothra

Self-taught cook exploring global vegetarian cuisine from my Atlanta kitchen.

Learn more about me →
⏱️ 00:00