Mushroom and Snow Pea Stir-Fry
Chinese Medium

Mushroom and Snow Pea Stir-Fry

Savory glazed mushrooms and crisp vegetables in a classic soy-ginger sauce

chinesevegetarianvegandairy-freeweeknightdinner
β€” (0 ratings)
⏱️ 45 minutes 20 minutes prep · 20 minutes cook
🍽️ 4 Serves
210 Calories
6g Protein
18g Carbs
13g Fat

Why This Recipe Works

The secret to this stir-fry is browning the mushrooms in batches to develop a deep, meaty sear before glazing them. This technique ensures they remain firm and savory rather than steaming in the pan.


Instructions

1

Whisk the soy sauce, rice vinegar, and sugar together in a small bowl until the sugar is dissolved.

2

Whisk the vegetable broth, soy sauce, and cornstarch in a separate bowl until no lumps of starch remain.

3

Combine the garlic, ginger, pepper flakes, and a teaspoon of oil in a small bowl. Heat a tablespoon of oil in a 12-inch nonstick skillet over high heat until the oil shimmers. Add half of the mushrooms and cook without stirring for 2 to 3 minutes until the bottoms are deeply browned. Flip the mushrooms, reduce the heat to medium, and cook for about 5 minutes until the second side is browned and the mushrooms are tender. Transfer the first batch to a bowl and repeat the process with another tablespoon of oil and the remaining mushrooms.

4

Return all the cooked mushrooms to the skillet and pour in the glaze. Cook over medium-high heat, stirring frequently, for 1 to 2 minutes until the liquid reduces to a thick, glossy coating. Transfer the mushrooms back to their bowl.

5

Wipe the skillet clean with paper towels, add the remaining oil, and return to high heat. Add the snow peas and carrots and cook, stirring occasionally, for about 5 minutes until they are bright and crisp-tender. Clear the center of the skillet, add the garlic-ginger mixture, and mash it into the pan surface. Cook until fragrant, about 30 seconds, then stir it into the vegetables.

6

Return the mushrooms to the skillet. Give the sauce a quick whisk to recombine, then add it to the pan. Cook, stirring constantly, for 1 to 2 minutes until the sauce thickens and binds the vegetables together. Serve immediately while the snow peas are still vibrant.


🍽️ Complete the Meal

Steamed jasmine rice Brown rice
🧊
Storage: Refrigerate for up to 3 days.

Frequently Asked Questions

Can I freeze this recipe?

Refrigerate for up to 3 days.

Rohit Bothra
Recipe by

Rohit Bothra

Self-taught cook exploring global vegetarian cuisine from my Atlanta kitchen.

Learn more about me β†’
⏱️ 00:00