Pasta with Kale and White Beans
Italian-inspired Easy

Pasta with Kale and White Beans

A rustic, creamy pasta using mashed beans as a protein-rich sauce base

italianvegetarianweeknightpastahigh-fiber
β€” (0 ratings)
⏱️ 45 minutes 15 minutes prep · 30 minutes cook
🍽️ 4 Serves
685 Calories
26g Protein
98g Carbs
19g Fat

Why This Recipe Works

Mashing a portion of the white beans directly into the broth creates a creamy, starch-rich sauce without the need for heavy cream. It is a brilliant way to turn humble pantry staples into a satisfying, nutrient-dense dinner.


Instructions

1

Heat the oil in a Dutch oven over medium heat until it begins to shimmer. Stir in the onions and cook until softened and translucent, about 5 minutes.

2

Stir in the garlic, thyme, and red pepper flakes and cook until fragrant. Add the beans and broth, bring the mixture to a simmer, and cook until the sauce has thickened slightly, about 10 minutes.

3

Stir in the kale, cover the pot, and cook until the leaves are tender, about 10 to 12 minutes, stirring occasionally to ensure even cooking.

4

Remove the pot from the heat and mash a portion of the beans against the side of the pot with a wooden spoon to create a creamier consistency. Season with salt and pepper to taste.

5

While the sauce is simmering, bring 4 quarts of water to a boil in a separate large pot. Add the pasta and salt and cook until al dente. Reserve 1/2 cup of the cooking water before draining the pasta.

6

Return the drained pasta to its pot and stir in the kale-bean mixture, half of the Parmesan, and the remaining oil. Toss to combine, adding the reserved cooking water as needed to adjust the sauce consistency.

7

Season with additional salt and pepper, then serve in warm bowls topped with the remaining Parmesan.


🍽️ Complete the Meal

πŸ“…
Make Ahead: The kale and bean base can be prepared up to a day in advance and reheated gently while the pasta boils.
🧊
Storage: Store leftovers in an airtight container for up to 3 days; add a splash of water when reheating to loosen the sauce.

Frequently Asked Questions

Can I freeze this recipe?

Store leftovers in an airtight container for up to 3 days; add a splash of water when reheating to loosen the sauce.

Can I make this ahead of time?

The kale and bean base can be prepared up to a day in advance and reheated gently while the pasta boils.

What substitutions can I make?
  • Cannellini beans: Great Northern beans
Rohit Bothra
Recipe by

Rohit Bothra

Self-taught cook exploring global vegetarian cuisine from my Atlanta kitchen.

Learn more about me β†’
⏱️ 00:00