Char Siu Tofu
Chinese-inspired Easy

Char Siu Tofu

Thick slabs of extra-firm tofu glazed in a rich, aromatic five-spice sauce

veganvegetariandairy-freechinese-inspireddinnerweeknight
β€” (0 ratings)
⏱️ 45 minutes 15 minutes prep · 15 minutes cook
🍽️ 2 Serves
485 Calories
20g Protein
42g Carbs
28g Fat

Why This Recipe Works

These tofu slices replicate the iconic Cantonese barbecue glaze with a balance of sweet hoisin, warm five-spice, and a hint of heat. Pressing the tofu is essential here, as it allows the slabs to sear properly and absorb the syrupy sauce without becoming waterlogged.


Instructions

1

Slice the pressed block of tofu through the middle to create 1-inch-thick slabs.

2

Whisk the hoisin sauce, brown sugar, soy sauce, garlic, ginger, Shaoxing wine, five-spice powder, and sriracha in a small bowl until combined.

3

Heat a large, nonstick skillet over medium-high heat and add the oil. Once the oil shimmers, add the tofu slabs and pan-fry until they are lightly browned and crisp, about 4 minutes per side.

4

Remove the tofu from the pan and let it cool for 5 minutes, then slice each slab into 1-inch-thick strips.

5

Add the sauce to the same pan over medium heat, stirring until the sugar is fully dissolved. Bring the mixture to a boil over medium-high heat, then lower the heat back to medium, stirring constantly to ensure the sugar doesn't burn.

6

Add the sliced tofu back to the pan and baste the pieces with the sauce. Continue to cook for 7 to 8 minutes until the tofu has absorbed the flavors.

7

Increase the heat to high and cook for 2 minutes, moving the tofu frequently, until the sauce reduces into a thick, glossy glaze.

8

Garnish with sesame seeds and scallions and serve hot alongside rice, blanched greens, or tucked into steamed buns.


🍽️ Complete the Meal

Steamed Jasmine RiceGua Bao (Steamed Buns)Flat Rice Noodles Blanched Bok ChoyGai Lan with Garlic
🧊
Storage: Refrigerate for up to 3 days.

Frequently Asked Questions

Can I freeze this recipe?

Refrigerate for up to 3 days.

What substitutions can I make?
  • dark brown sugar: adjust to taste
  • Shaoxing wine: dry sherry
Rohit Bothra
Recipe by

Rohit Bothra

Self-taught cook exploring global vegetarian cuisine from my Atlanta kitchen.

Learn more about me β†’
⏱️ 00:00