Teriyaki Sauce
Japanese Easy

Teriyaki Sauce

A versatile four-ingredient Japanese staple for glazing and dipping

japaneseveganvegetariandairy-freequickcondiment
(0 ratings)
⏱️ 15 minutes 5 minutes prep · 9 minutes cook
🍽️ 8 cups Makes
85 Calories
1g Protein
14g Carbs
0g Fat

Why This Recipe Works

This classic Japanese staple relies on the natural sugars in mirin and sake to create a glossy finish without the need for thickeners. Use it as a thin dipping sauce or reduce it with a cornstarch slurry for a rich, clingy glaze.


Instructions

1

Combine the sake, mirin, soy sauce, and sugar in a medium saucepan over medium-high heat. Stir in one direction until the sugar has completely dissolved and the mixture begins to boil.

2

Let the sauce boil over medium-high heat until it reduces slightly and feels more viscous from the natural sugars, about 7 to 8 minutes.

3

To transform the sauce into a glaze, whisk the cornstarch and water together in a small bowl until no lumps remain. Stir the slurry into the boiling sauce and cook until it thickens into a glossy coating, about 2 minutes.

4

Remove from the heat and let the sauce cool completely—it will continue to thicken significantly as the temperature drops. Serve with your favorite grilled proteins or vegetables.


🍽️ Complete the Meal

Steamed jasmine rice Grilled tofu skewers Roasted broccoli
🧊
Storage: Refrigerate for up to 2 weeks.

Frequently Asked Questions

Can I freeze this recipe?

Refrigerate for up to 2 weeks.

What substitutions can I make?
  • hon mirin: standard mirin
  • dark brown sugar: cane sugar
Rohit Bothra
Recipe by

Rohit Bothra

Self-taught cook exploring global vegetarian cuisine from my Atlanta kitchen.

Learn more about me →
⏱️ 00:00