Turkish Nut Sauce
Turkish Easy

Turkish Nut Sauce

A velvety, dairy-free dip made with toasted nuts and bread

turkishveganvegetariandairy-freesnackdipno-cook
β€” (0 ratings)
⏱️ 10 minutes Total Time
🍽️ 8 cups Makes
170 Calories
3g Protein
5g Carbs
16g Fat

Why This Recipe Works

Known as Tarator, this smooth Turkish sauce achieves its luxurious texture through the emulsification of nuts, bread, and oil rather than eggs or dairy. Toasting the nuts is essential for a deep, complex flavor that balances the bright lemon and sharp garlic.


Instructions

1

Combine the bread, water, toasted nuts, olive oil, lemon juice, garlic, and cayenne in a blender or food processor.

2

Process the mixture until it is completely smooth and reaches a velvety, creamy consistency.

3

Taste and adjust the seasoning with salt and pepper. If the sauce feels too thick for dipping, pulse in extra water or lemon juice one tablespoon at a time to reach the desired consistency.

4

Serve at room temperature with bread or vegetables.


🍽️ Complete the Meal

Warm pita breadOlive oil and sea salt pita chips Raw vegetables Cucumber and tomato salad
🧊
Storage: Refrigerate for up to 3 days.

Frequently Asked Questions

Can I freeze this recipe?

Refrigerate for up to 3 days.

What substitutions can I make?
  • nuts: If using almonds or hazelnuts, ensure they are skinless for a smoother texture.
Rohit Bothra
Recipe by

Rohit Bothra

Self-taught cook exploring global vegetarian cuisine from my Atlanta kitchen.

Learn more about me β†’
⏱️ 00:00